Host Protein General Information
| Protein Name |
maleylacetoacetate isomerase
|
Gene Name |
.
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Aedes albopictus
|
Uniprot Entry Name |
A0A023EMR1_AEDAL
|
||||||
| External Link | |||||||||
| Uniprot ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Dengue virus 4 (strain H241) | 3'UTR | RNA Info | UV cross-linking (UVX) | C6/36 Cells (Aedes albopictus cell line) | . | . | 5 day | . | . |
Protein Sequence Information
|
SACQTAIATSATHPPSSGLHLFLSSRWNDTAAKINYSKFHNAMSLSAMSKPILYSYWRSSCSWRVRIALNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLVESLAIMHYLEETRPQRPLLPQDVLKRAKVREICEVIASGVQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAIEKLLSTSAGKFCVGDEITLADCCLVPQVFNARRFHVDLRPYPII
Click to Show/Hide
|
