Host Protein General Information
| Protein Name |
C-C chemokine receptor type 5
|
Gene Name |
CCR5
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
CCR5_HUMAN
|
||||||
| Protein Families |
G-protein coupled receptor 1 family
|
||||||||
| Subcellular Location |
Cell membrane
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Viral life cycle - HIV-1 | hsa03250 |
Pathway Map
|
|||||||
| Virion - Human immunodeficiency virus | hsa03260 |
Pathway Map
|
|||||||
| Chemokine signaling pathway | hsa04062 |
Pathway Map
|
|||||||
| Toxoplasmosis | hsa05145 |
Pathway Map
|
|||||||
| Human cytomegalovirus infection | hsa05163 |
Pathway Map
|
|||||||
| Kaposi sarcoma-associated herpesvirus infection | hsa05167 |
Pathway Map
|
|||||||
| Human immunodeficiency virus 1 infection | hsa05170 |
Pathway Map
|
|||||||
| Cytokine-cytokine receptor interaction | hsa04060 |
Pathway Map
|
|||||||
| Viral protein interaction with cytokine and cytokine receptor | hsa04061 |
Pathway Map
|
|||||||
| Endocytosis | hsa04144 |
Pathway Map
|
|||||||
| Viral carcinogenesis | hsa05203 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Human immunodeficiency virus type 1 (strain JR-CSF) | 5'UTR - 3'UTR | RNA Info | Genome-wide CRISPR screen strategy | GXRCas9 Cells (Human acute lymphoid leukemia T lymphoid cell line) | . | Lymph | . | . | . |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
|
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Click to Show/Hide
|
