Host Protein General Information
Protein Name |
ARC16-2
|
Gene Name |
ARPC5L
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
ARP5L_HUMAN
|
||||||
Protein Families |
ARPC5 family
|
||||||||
Subcellular Location |
Cytoplasm; cytoskeleton
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Fc gamma R-mediated phagocytosis | hsa04666 |
Pathway Map ![]() |
|||||||
Bacterial invasion of epithelial cells | hsa05100 |
Pathway Map ![]() |
|||||||
Pathogenic Escherichia coli infection | hsa05130 |
Pathway Map ![]() |
|||||||
Shigellosis | hsa05131 |
Pathway Map ![]() |
|||||||
Salmonella infection | hsa05132 |
Pathway Map ![]() |
|||||||
Yersinia infection | hsa05135 |
Pathway Map ![]() |
|||||||
Regulation of actin cytoskeleton | hsa04810 |
Pathway Map ![]() |
|||||||
Tight junction | hsa04530 |
Pathway Map ![]() |
|||||||
Endocytosis | hsa04144 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Dengue virus 1 (strain D1/SG/05K2402DK1/2005) | 3'UTR | RNA Info | RNA chromatography and quantitative mass spectrometry | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | . | . |
Protein Sequence Information
MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Click to Show/Hide
|