Host Protein General Information
| Protein Name |
Protein lifeguard 4
|
Gene Name |
TMBIM4
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
LFG4_HUMAN
|
||||||
| Protein Families |
BI1 family, LFG subfamily
|
||||||||
| Subcellular Location |
Golgi apparatus membrane
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Hepatitis C virus (strain JFH-1) | 5'UTR | RNA Info | . | HuH-7 Cells (Human hepatocellular carcinoma cell); Huh-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 24 h & 48h | . | . |
Protein Sequence Information
|
MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEAVNKK
Click to Show/Hide
|
