Host Protein General Information
| Protein Name |
Sm-like protein LSM7
|
Gene Name |
LSM7
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Arabidopsis thaliana
|
Uniprot Entry Name |
LSM7_ARATH
|
||||||
| Protein Families |
SnRNP Sm proteins family
|
||||||||
| Subcellular Location |
Cytoplasm
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Hepatitis C virus (strain JFH-1) | 3'UTR | RNA Info | Assay | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Cervix | . | . | . |
| Hepatitis C virus (strain JFH-1) | 5'UTR | RNA Info | Assay | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Cervix | . | . | . |
Protein Sequence Information
|
MSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFVRDHDDPLKTTDQTRRLGLIVCRGTAVMLVSPTDGTEEIANPFVTAEAV
Click to Show/Hide
|
