Host Protein General Information
| Protein Name |
E3 ubiquitin-protein ligase RHA2A
|
Gene Name |
RHA2A
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Arabidopsis thaliana
|
Uniprot Entry Name |
RHA2A_ARATH
|
||||||
| EC Number |
2.3.2.27
|
||||||||
| Subcellular Location |
Cytoplasm
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Bovine viral diarrhea virus | 3'UTR | RNA Info | UV cross-linking/label transfer | B95a Cells (Marmoset lymphoblastoid cell line) | . | . | . | . | . |
| Bovine viral diarrhea virus | 5'UTR | RNA Info | UV cross-linking/label transfer | B95a Cells (Marmoset lymphoblastoid cell line) | . | . | . | . | . |
Protein Sequence Information
|
MGLQGQLSDVSSDSIPLMLLSLLAVFINHLRSFLLRLTSKSNPNLPVDDVSIASGLANIIVLADQLSLNRLFSYRCGDGGGGGSDCVVCLSKLKEGEEVRKLECRHVFHKKCLEGWLHQFNFTCPLCRSALVSDDCVSKTQRSVGRDLISCFSLH
Click to Show/Hide
|
