Host Protein General Information
Protein Name |
Putative uncharacterized protein RPP38-DT (RASGRP3)
|
Gene Name |
RASGRP3
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
CJ111_HUMAN
|
||||||
Subcellular Location |
Membrane; Single-pass membrane protein
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Wuhan-Hu-1/2019) | 5'UTR | RNA Info | RNA-protein interaction detection (RaPID) assay & liquid chromatography with tandem mass spectrometry (LC-MS/MS) | HEK293T cells | . | Liver | 48 h | Prot score = 17 | . |
Protein Sequence Information
MESLQTPQHRENQDKREKEYGVKHMPMGNNAGNLEPEKRKAVRVALSSATAAQNIPSSVHCGCSKQWRLRLPSESLQSRGQVMKRPNNILKLRNLDLLIYPWPELRRRQVASDLMSLLLLPAFSGLTWAPFLFLFTYLPPFLNLLTVGFVSYFLV
Click to Show/Hide
|