Host Protein General Information
| Protein Name |
Guanine nucleotide binding protein beta polypeptide 2-like 1 (SARNP)
|
Gene Name |
SARNP
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
I3QNU9_HUMAN
|
||||||
| Protein Families |
WD repeat G protein beta family
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | N region | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 cell line | . | Liver | . | P value < 0.05 | . |
Protein Sequence Information
|
MPCNFPLPFALHGAAILSRNVSWGSPFCMVERVFPVPAGGFSLSLSLQGGGRRGCGASFSKPSSAILVAAATHALAAAMTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRD
Click to Show/Hide
|
