Host Protein General Information
Protein Name |
39S ribosomal protein L22 (MRP-L22)
|
Gene Name |
MRPL22
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
RM22_HUMAN
|
||||||
Protein Families |
Universal ribosomal protein uL22 family
|
||||||||
Subcellular Location |
Mitochondrion
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/France/IDF-220-95/2020) | Not Specified Virus Region | RNA Info | ChIRP-M/S | HEK 293T cells stably expressing the human ACE2 receptor (293T-ACE2) | . | Embryonic kidneys | 48 h | SAINT score >= 0.79 | . |
Protein Sequence Information
MAAAVLGQLGALWIHNLRSRGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL
Click to Show/Hide
|