Host Protein General Information
| Protein Name |
Adenylate kinase 4 (AK 4)
|
Gene Name |
AK4
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
KAD4_HUMAN
|
||||||
| Protein Families |
Adenylate kinase family
|
||||||||
| EC Number |
2.7.4.1.; 2.7.4.6
|
||||||||
| Subcellular Location |
Mitochondrion matrix
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | Not Specified Virus Region | RNA Info | RNAantisensepurificationandquantitativemassspectrometry(RAP-MS); Tandemmasstag(TMT)labelling; liquidchromatographycoupledwithtandemmassspectrometry(LC-MS/MS); Westernblot | Huh7 cells (liver carcinoma celll ine) | . | Liver | 24h | log2 fold change = 3.28137E+14 | . |
Protein Sequence Information
|
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Click to Show/Hide
|
