Host Protein General Information
Protein Name |
Complex I-B12
|
Gene Name |
NDUFB3
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
NDUB3_HUMAN
|
||||||
Protein Families |
Complex I NDUFB3 subunit family
|
||||||||
Subcellular Location |
Mitochondrion inner membrane
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Chemical carcinogenesis - reactive oxygen species | hsa05208 |
Pathway Map ![]() |
|||||||
Diabetic cardiomyopathy | hsa05415 |
Pathway Map ![]() |
|||||||
Non-alcoholic fatty liver disease | hsa04932 |
Pathway Map ![]() |
|||||||
Oxidative phosphorylation | hsa00190 |
Pathway Map ![]() |
|||||||
Thermogenesis | hsa04714 |
Pathway Map ![]() |
|||||||
Metabolic pathways | hsa01100 |
Pathway Map ![]() |
|||||||
Retrograde endocannabinoid signaling | hsa04723 |
Pathway Map ![]() |
|||||||
Alzheimer disease | hsa05010 |
Pathway Map ![]() |
|||||||
Parkinson disease | hsa05012 |
Pathway Map ![]() |
|||||||
Amyotrophic lateral sclerosis | hsa05014 |
Pathway Map ![]() |
|||||||
Huntington disease | hsa05016 |
Pathway Map ![]() |
|||||||
Prion disease | hsa05020 |
Pathway Map ![]() |
|||||||
Pathways of neurodegeneration - multiple diseases | hsa05022 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Dengue virus 2 | 5'UTR - 3'UTR | RNA Info | Genome-wide RNA interference (RNAi) screen | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
Potential Drug(s) that Targets This Protein
Drug Name | DrunkBank ID | Pubchem ID | TTD ID | REF | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
ME-344 | . | 68026984 | D03IXK | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
NV-128 | . | 68026984 | D03IXK | DGIdb |
Protein Sequence Information
MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
Click to Show/Hide
|