Host Protein General Information
Protein Name |
MHC class II antigen DQB1
|
Gene Name |
HLA.DQB1
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
DQB1_HUMAN
|
||||||
Protein Families |
MHC class II family
|
||||||||
Subcellular Location |
Cell membrane; Single-pass type I membrane protein; Endoplasmic reticulum membrane; Single-pass type I membrane protein
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Antigen processing and presentation | hsa04612 |
Pathway Map ![]() |
|||||||
Hematopoietic cell lineage | hsa04640 |
Pathway Map ![]() |
|||||||
Th1 and Th2 cell differentiation | hsa04658 |
Pathway Map ![]() |
|||||||
Th17 cell differentiation | hsa04659 |
Pathway Map ![]() |
|||||||
Intestinal immune network for IgA production | hsa04672 |
Pathway Map ![]() |
|||||||
Staphylococcus aureus infection | hsa05150 |
Pathway Map ![]() |
|||||||
Tuberculosis | hsa05152 |
Pathway Map ![]() |
|||||||
Leishmaniasis | hsa05140 |
Pathway Map ![]() |
|||||||
Toxoplasmosis | hsa05145 |
Pathway Map ![]() |
|||||||
Influenza A | hsa05164 |
Pathway Map ![]() |
|||||||
Human T-cell leukemia virus 1 infection | hsa05166 |
Pathway Map ![]() |
|||||||
Herpes simplex virus 1 infection | hsa05168 |
Pathway Map ![]() |
|||||||
Epstein-Barr virus infection | hsa05169 |
Pathway Map ![]() |
|||||||
Viral myocarditis | hsa05416 |
Pathway Map ![]() |
|||||||
Type I diabetes mellitus | hsa04940 |
Pathway Map ![]() |
|||||||
Asthma | hsa05310 |
Pathway Map ![]() |
|||||||
Autoimmune thyroid disease | hsa05320 |
Pathway Map ![]() |
|||||||
Inflammatory bowel disease | hsa05321 |
Pathway Map ![]() |
|||||||
Systemic lupus erythematosus | hsa05322 |
Pathway Map ![]() |
|||||||
Rheumatoid arthritis | hsa05323 |
Pathway Map ![]() |
|||||||
Allograft rejection | hsa05330 |
Pathway Map ![]() |
|||||||
Graft-versus-host disease | hsa05332 |
Pathway Map ![]() |
|||||||
Cell adhesion molecules | hsa04514 |
Pathway Map ![]() |
|||||||
Phagosome | hsa04145 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | . | . |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH
Click to Show/Hide
|