Host Protein General Information
| Protein Name |
Homeotic protein antennapedia
|
Gene Name |
Antp
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Drosophila melanogaster
|
Uniprot Entry Name |
ANTP_DROME
|
||||||
| Protein Families |
Antp homeobox family
|
||||||||
| Subcellular Location |
Nucleus
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Dengue virus 2 | 5'UTR - 3'UTR | RNA Info | Genome-wide RNA interference (RNAi) screen | D.Mel-2 Cells (S2 Drosophila embryonic cell) | . | embryo | 48 h | P_value = 0.0067 | . |
Protein Sequence Information
|
MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSPQ
Click to Show/Hide
|
