Host Protein General Information
| Protein Name |
Histone H2A.Z
|
Gene Name |
H2AZ1
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
H2AZ_HUMAN
|
||||||
| Protein Families |
Histone H2A family
|
||||||||
| Subcellular Location |
Nucleus; Chromosome
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Neutrophil extracellular trap formation | hsa04613 |
Pathway Map
|
|||||||
| Necroptosis | hsa04217 |
Pathway Map
|
|||||||
| Systemic lupus erythematosus | hsa05322 |
Pathway Map
|
|||||||
| Alcoholism | hsa05034 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Zika virus (strain MR766) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 20 h | MIST = 0.873658937 | . |
Protein Sequence Information
|
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
Click to Show/Hide
|
