Host Protein General Information
| Protein Name |
eIF-2-beta
|
Gene Name |
EIF2S2
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
IF2B_HUMAN
|
||||||
| Protein Families |
EIF-2-beta/eIF-5 family
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Sindbis virus | 5'UTR - 3'UTR | RNA Info | comparative RIC | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 18 h | P = 1.27969104745216 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | N region | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Calu-3 cell line | . | Liver | . | P value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | Not Specified Virus Region | RNA Info | RNAantisensepurificationandquantitativemassspectrometry(RAP-MS); Tandemmasstag(TMT)labelling; liquidchromatographycoupledwithtandemmassspectrometry(LC-MS/MS); Westernblot | Huh7 cells (liver carcinoma celll ine) | . | Liver | 24h | log2 fold change = 3.66159E+14 | . |
Protein Sequence Information
|
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
Click to Show/Hide
|
