Host Protein General Information
Protein Name |
DNA repair protein complementing XP-A cells
|
Gene Name |
XPA
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
XPA_HUMAN
|
||||||
Protein Families |
XPA family
|
||||||||
Subcellular Location |
Nucleus
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Platinum drug resistance | hsa01524 |
Pathway Map ![]() |
|||||||
Nucleotide excision repair | hsa03420 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Zika virus | 3'UTR | RNA Info | RNA-protein interaction detection (RaPID) | HEK293 Cells (Human embryonic kidney cell) | . | Kidney | 42 h | Saint score = 0.92 | . |
Zika virus | 5'UTR | RNA Info | RNA-protein interaction detection (RaPID) | HEK293 Cells (Human embryonic kidney cell) | . | Kidney | 42 h | Saint score = 0.92 | . |
Protein Sequence Information
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
Click to Show/Hide
|