Home
Search 
BLAST
Manual
DownloadHost Protein General Information
| Protein Name |
G1/S-specific cyclin-D3
|
Gene Name |
CCND3
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
CCND3_HUMAN
|
||||||
| Protein Families |
Cyclin family, Cyclin D subfamily
|
||||||||
| Subcellular Location |
Nucleus
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Measles | hsa05162 |
Pathway Map 
|
|||||||
| Influenza A | hsa05164 |
Pathway Map 
|
|||||||
| Human papillomavirus infection | hsa05165 |
Pathway Map 
|
|||||||
| Human T-cell leukemia virus 1 infection | hsa05166 |
Pathway Map 
|
|||||||
| Epstein-Barr virus infection | hsa05169 |
Pathway Map 
|
|||||||
| Pathways in cancer | hsa05200 |
Pathway Map 
|
|||||||
| Viral carcinogenesis | hsa05203 |
Pathway Map 
|
|||||||
| Chemical carcinogenesis - receptor activation | hsa05207 |
Pathway Map 
|
|||||||
| Cell cycle | hsa04110 |
Pathway Map 
|
|||||||
| p53 signaling pathway | hsa04115 |
Pathway Map 
|
|||||||
| Cellular senescence | hsa04218 |
Pathway Map 
|
|||||||
| Focal adhesion | hsa04510 |
Pathway Map 
|
|||||||
| PI3K-Akt signaling pathway | hsa04151 |
Pathway Map 
|
|||||||
| Wnt signaling pathway | hsa04310 |
Pathway Map 
|
|||||||
| Hippo signaling pathway | hsa04390 |
Pathway Map 
|
|||||||
| JAK-STAT signaling pathway | hsa04630 |
Pathway Map 
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | . | . |
Potential Drug(s) that Targets This Protein
| Drug Name | DrunkBank ID | Pubchem ID | TTD ID | REF | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ABEMACICLIB | . | 46220502 | D05SBO | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PALBOCICLIB | . | 5330286 | D00UZR | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RIBOCICLIB | . | 44631912 | D08MXP | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Sequence Information
|
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
Click to Show/Hide
|