Host Protein General Information
Protein Name |
GTP cyclohydrolase 1
|
Gene Name |
GCH1
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
GCH1_HUMAN
|
||||||
Protein Families |
GTP cyclohydrolase I family
|
||||||||
EC Number |
3.5.4.16
|
||||||||
Subcellular Location |
Cytoplasm
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Metabolic pathways | hsa01100 |
Pathway Map ![]() |
|||||||
Biosynthesis of cofactors | hsa01240 |
Pathway Map ![]() |
|||||||
Folate biosynthesis | hsa00790 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Dengue virus 2 | 5'UTR - 3'UTR | RNA Info | Genome-wide RNA interference (RNAi) screen | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
Click to Show/Hide
|