Host Protein General Information
Protein Name |
Cathepsin K
|
Gene Name |
CTSK
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
CATK_HUMAN
|
||||||
Protein Families |
Peptidase C1 family
|
||||||||
EC Number |
3.4.22.38
|
||||||||
Subcellular Location |
Lysosome
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Toll-like receptor signaling pathway | hsa04620 |
Pathway Map ![]() |
|||||||
Apoptosis | hsa04210 |
Pathway Map ![]() |
|||||||
Osteoclast differentiation | hsa04380 |
Pathway Map ![]() |
|||||||
Rheumatoid arthritis | hsa05323 |
Pathway Map ![]() |
|||||||
Lysosome | hsa04142 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | . | . |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Click to Show/Hide
|