Host Protein General Information
Protein Name |
MAP kinase kinase 6
|
Gene Name |
MAP2K6
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
MP2K6_HUMAN
|
||||||
Protein Families |
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily
|
||||||||
EC Number |
2.7.12.2
|
||||||||
Subcellular Location |
Nucleus
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Toll-like receptor signaling pathway | hsa04620 |
Pathway Map ![]() |
|||||||
Fc epsilon RI signaling pathway | hsa04664 |
Pathway Map ![]() |
|||||||
Salmonella infection | hsa05132 |
Pathway Map ![]() |
|||||||
Yersinia infection | hsa05135 |
Pathway Map ![]() |
|||||||
Toxoplasmosis | hsa05145 |
Pathway Map ![]() |
|||||||
Hepatitis B | hsa05161 |
Pathway Map ![]() |
|||||||
Human cytomegalovirus infection | hsa05163 |
Pathway Map ![]() |
|||||||
Kaposi sarcoma-associated herpesvirus infection | hsa05167 |
Pathway Map ![]() |
|||||||
Epstein-Barr virus infection | hsa05169 |
Pathway Map ![]() |
|||||||
Human immunodeficiency virus 1 infection | hsa05170 |
Pathway Map ![]() |
|||||||
PD-L1 expression and PD-1 checkpoint pathway in cancer | hsa05235 |
Pathway Map ![]() |
|||||||
Lipid and atherosclerosis | hsa05417 |
Pathway Map ![]() |
|||||||
Fluid shear stress and atherosclerosis | hsa05418 |
Pathway Map ![]() |
|||||||
Cellular senescence | hsa04218 |
Pathway Map ![]() |
|||||||
Osteoclast differentiation | hsa04380 |
Pathway Map ![]() |
|||||||
Alcoholic liver disease | hsa04936 |
Pathway Map ![]() |
|||||||
GnRH signaling pathway | hsa04912 |
Pathway Map ![]() |
|||||||
Growth hormone synthesis, secretion and action | hsa04935 |
Pathway Map ![]() |
|||||||
Amyotrophic lateral sclerosis | hsa05014 |
Pathway Map ![]() |
|||||||
Pathways of neurodegeneration - multiple diseases | hsa05022 |
Pathway Map ![]() |
|||||||
Inflammatory mediator regulation of TRP channels | hsa04750 |
Pathway Map ![]() |
|||||||
MAPK signaling pathway | hsa04010 |
Pathway Map ![]() |
|||||||
Rap1 signaling pathway | hsa04015 |
Pathway Map ![]() |
|||||||
TNF signaling pathway | hsa04668 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | . | . |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Click to Show/Hide
|