Host Protein General Information

  Protein Name
Ras-related C3 botulinum toxin substrate 1
  Gene Name
RAC1
  Host Species
Homo sapiens
  Uniprot Entry Name
RAC1_HUMAN
  Protein Families
Small GTPase superfamily, Rho family
  EC Number
3.6.5.2
  Subcellular Location
Cell membrane
  External Link
NCBI Gene ID
5879
Uniprot ID
P63000
Ensembl ID
ENSG00000136238
HGNC ID
9801
  Related KEGG Pathway
Chemokine signaling pathway hsa04062            Pathway Map 
Neutrophil extracellular trap formation hsa04613            Pathway Map 
Toll-like receptor signaling pathway hsa04620            Pathway Map 
Natural killer cell mediated cytotoxicity hsa04650            Pathway Map 
B cell receptor signaling pathway hsa04662            Pathway Map 
Fc epsilon RI signaling pathway hsa04664            Pathway Map 
Fc gamma R-mediated phagocytosis hsa04666            Pathway Map 
Leukocyte transendothelial migration hsa04670            Pathway Map 
Bacterial invasion of epithelial cells hsa05100            Pathway Map 
Epithelial cell signaling in Helicobacter pylori infection hsa05120            Pathway Map 
Pathogenic Escherichia coli infection hsa05130            Pathway Map 
Shigellosis hsa05131            Pathway Map 
Salmonella infection hsa05132            Pathway Map 
Yersinia infection hsa05135            Pathway Map 
Human cytomegalovirus infection hsa05163            Pathway Map 
Kaposi sarcoma-associated herpesvirus infection hsa05167            Pathway Map 
Epstein-Barr virus infection hsa05169            Pathway Map 
Human immunodeficiency virus 1 infection hsa05170            Pathway Map 
Pathways in cancer hsa05200            Pathway Map 
Viral carcinogenesis hsa05203            Pathway Map 
Proteoglycans in cancer hsa05205            Pathway Map 
Chemical carcinogenesis - reactive oxygen species hsa05208            Pathway Map 
Choline metabolism in cancer hsa05231            Pathway Map 
Colorectal cancer hsa05210            Pathway Map 
Renal cell carcinoma hsa05211            Pathway Map 
Pancreatic cancer hsa05212            Pathway Map 
Diabetic cardiomyopathy hsa05415            Pathway Map 
Viral myocarditis hsa05416            Pathway Map 
Lipid and atherosclerosis hsa05417            Pathway Map 
Fluid shear stress and atherosclerosis hsa05418            Pathway Map 
Regulation of actin cytoskeleton hsa04810            Pathway Map 
Focal adhesion hsa04510            Pathway Map 
Adherens junction hsa04520            Pathway Map 
Tight junction hsa04530            Pathway Map 
Axon guidance hsa04360            Pathway Map 
Osteoclast differentiation hsa04380            Pathway Map 
Pancreatic secretion hsa04972            Pathway Map 
Non-alcoholic fatty liver disease hsa04932            Pathway Map 
AGE-RAGE signaling pathway in diabetic complications hsa04933            Pathway Map 
Neurotrophin signaling pathway hsa04722            Pathway Map 
Amyotrophic lateral sclerosis hsa05014            Pathway Map 
Prion disease hsa05020            Pathway Map 
Pathways of neurodegeneration - multiple diseases hsa05022            Pathway Map 
MAPK signaling pathway hsa04010            Pathway Map 
Ras signaling pathway hsa04014            Pathway Map 
Rap1 signaling pathway hsa04015            Pathway Map 
cAMP signaling pathway hsa04024            Pathway Map 
Sphingolipid signaling pathway hsa04071            Pathway Map 
PI3K-Akt signaling pathway hsa04151            Pathway Map 
Wnt signaling pathway hsa04310            Pathway Map 
VEGF signaling pathway hsa04370            Pathway Map 
Phagosome hsa04145            Pathway Map 
  3D Structure
PDB ID: 1.00E+96 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 3 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h . .

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
azathioprine . 2265  D07QCE  DrugCentral
DABRAFENIB . 44462760  D05ROI  DGIdb
PLX-4720 . 24180719  D0F5JZ  DGIdb
VEMURAFENIB . 42611257  D0Y9EW  DGIdb

Protein Sequence Information

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
    Click to Show/Hide