Host Protein General Information
Protein Name |
Histone H3.1
|
Gene Name |
H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3C10; H3C11; H3C12
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
H31_HUMAN
|
||||||
Protein Families |
Histone H3 family
|
||||||||
Subcellular Location |
Nucleus; Chromosome
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Neutrophil extracellular trap formation | hsa04613 |
Pathway Map ![]() |
|||||||
Shigellosis | hsa05131 |
Pathway Map ![]() |
|||||||
Transcriptional misregulation in cancer | hsa05202 |
Pathway Map ![]() |
|||||||
Systemic lupus erythematosus | hsa05322 |
Pathway Map ![]() |
|||||||
Alcoholism | hsa05034 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Hepatitis E virus | 3'UTR | RNA Info | RNA-protein interaction detection (RaPID) assay coupled to liquid chromatography with tandem mass spectrometry (LC-MS/MS) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | . | . | . |
Protein Sequence Information
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Click to Show/Hide
|