Host Protein General Information
| Protein Name |
Histone H3.1
|
Gene Name |
H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3C10; H3C11; H3C12
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
H31_HUMAN
|
||||||
| Protein Families |
Histone H3 family
|
||||||||
| Subcellular Location |
Nucleus; Chromosome
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Neutrophil extracellular trap formation | hsa04613 |
Pathway Map
|
|||||||
| Shigellosis | hsa05131 |
Pathway Map
|
|||||||
| Transcriptional misregulation in cancer | hsa05202 |
Pathway Map
|
|||||||
| Systemic lupus erythematosus | hsa05322 |
Pathway Map
|
|||||||
| Alcoholism | hsa05034 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Hepatitis E virus | 3'UTR | RNA Info | RNA-protein interaction detection (RaPID) assay coupled to liquid chromatography with tandem mass spectrometry (LC-MS/MS) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | . | . | . |
Protein Sequence Information
|
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Click to Show/Hide
|
