Host Protein General Information
| Protein Name |
Interleukin-10 receptor subunit beta
|
Gene Name |
IL10RB
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
I10R2_HUMAN
|
||||||
| Protein Families |
Type II cytokine receptor family
|
||||||||
| Subcellular Location |
Membrane
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Toxoplasmosis | hsa05145 |
Pathway Map
|
|||||||
| Tuberculosis | hsa05152 |
Pathway Map
|
|||||||
| Human cytomegalovirus infection | hsa05163 |
Pathway Map
|
|||||||
| Cytokine-cytokine receptor interaction | hsa04060 |
Pathway Map
|
|||||||
| Viral protein interaction with cytokine and cytokine receptor | hsa04061 |
Pathway Map
|
|||||||
| JAK-STAT signaling pathway | hsa04630 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | . | . |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
|
MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS
Click to Show/Hide
|
