Host Protein General Information
Protein Name |
Peptidyl-prolyl cis-trans isomerase Pin1
|
Gene Name |
PIN1
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
PIN1_HUMAN
|
||||||
EC Number |
5.2.1.8
|
||||||||
Subcellular Location |
Nucleus
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
RIG-I-like receptor signaling pathway | hsa04622 |
Pathway Map ![]() |
|||||||
Viral life cycle - HIV-1 | hsa03250 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Hepatitis B virus (strain ayw) | 5'UTR - 3'UTR | RNA Info | Co-immunoprecipitation mass spectrometry (Co-IP/MS) | HepaRG Cell (Human bipotent progenitor cell line) | . | Liver | 1 h | P-value (- Benzonase) = 8.07E-04 | . |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Click to Show/Hide
|