Host Protein General Information
| Protein Name |
Dynein axonemal light chain 1
|
Gene Name |
DNAL1
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
DNAL1_HUMAN
|
||||||
| Protein Families |
Dynein light chain LC1-type family
|
||||||||
| Subcellular Location |
Cytoplasm; cytoskeleton; cilium axoneme
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Motor proteins | hsa04814 |
Pathway Map
|
|||||||
| Amyotrophic lateral sclerosis | hsa05014 |
Pathway Map
|
|||||||
| Huntington disease | hsa05016 |
Pathway Map
|
|||||||
| Pathways of neurodegeneration - multiple diseases | hsa05022 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Human immunodeficiency virus type 1 | 5'UTR - 3'UTR | RNA Info | Genome-wide siRNA screens | HeLa P4.2 Cells (Human cervical carcinoma cell) | . | Cervix | 48 h | . | . |
| Human immunodeficiency virus type 1 | 5'UTR - 3'UTR | RNA Info | Genome-wide siRNA screens | HeLa P4.2 Cells (Human cervical carcinoma cell) | . | Cervix | 48 h | . | . |
Protein Sequence Information
|
MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
Click to Show/Hide
|
