Host Protein General Information
Protein Name |
Dynein axonemal light chain 1
|
Gene Name |
DNAL1
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
DNAL1_HUMAN
|
||||||
Protein Families |
Dynein light chain LC1-type family
|
||||||||
Subcellular Location |
Cytoplasm; cytoskeleton; cilium axoneme
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Motor proteins | hsa04814 |
Pathway Map ![]() |
|||||||
Amyotrophic lateral sclerosis | hsa05014 |
Pathway Map ![]() |
|||||||
Huntington disease | hsa05016 |
Pathway Map ![]() |
|||||||
Pathways of neurodegeneration - multiple diseases | hsa05022 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Human immunodeficiency virus type 1 | 5'UTR - 3'UTR | RNA Info | Genome-wide siRNA screens | HeLa P4.2 Cells (Human cervical carcinoma cell) | . | Cervix | 48 h | . | . |
Human immunodeficiency virus type 1 | 5'UTR - 3'UTR | RNA Info | Genome-wide siRNA screens | HeLa P4.2 Cells (Human cervical carcinoma cell) | . | Cervix | 48 h | . | . |
Protein Sequence Information
MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
Click to Show/Hide
|