Host Protein General Information
Protein Name |
CG1740 protein
|
Gene Name |
Ntf-2
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Drosophila melanogaster
|
Uniprot Entry Name |
Q6WAR9_DROME
|
||||||
Subcellular Location |
Cytoplasm
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Dengue virus 2 | 5'UTR - 3'UTR | RNA Info | Genome-wide RNA interference (RNAi) screen | D.Mel-2 Cells (S2 Drosophila embryonic cell) | . | embryo | 48 h | P_value = 0.044 | . |
Protein Sequence Information
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQGAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQ
Click to Show/Hide
|