Host Protein General Information
Protein Name |
40S ribosomal protein S27-like
|
Gene Name |
RPS27L
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
RS27L_HUMAN
|
||||||
Protein Families |
Eukaryotic ribosomal protein eS27 family
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Coronavirus disease - COVID-19 | hsa05171 |
Pathway Map ![]() |
|||||||
Ribosome | hsa03010 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) | Not Specified Virus Region | RNA Info | UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) | Calu-3 cells (Human lung cancer cells) | . | Lung | 24 h | adj.P.Val = 0.071 | . |
Hepatitis B virus (strain ayw) | 5'UTR - 3'UTR | RNA Info | Co-immunoprecipitation mass spectrometry (Co-IP/MS) | HepaRG Cell (Human bipotent progenitor cell line) | . | Liver | 1 h | P-value (+ Benzonase) = 5.63E-05 | . |
Protein Sequence Information
MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Click to Show/Hide
|