Host Protein General Information
| Protein Name |
Pyridoxal phosphate phosphatase PHOSPHO2
|
Gene Name |
PHOSPHO2
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
PHOP2_HUMAN
|
||||||
| Protein Families |
HAD-like hydrolase superfamily, PHOSPHO family
|
||||||||
| EC Number |
3.1.3.74
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Metabolic pathways | hsa01100 |
Pathway Map
|
|||||||
| Biosynthesis of cofactors | hsa01240 |
Pathway Map
|
|||||||
| Vitamin B6 metabolism | hsa00750 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Dengue virus 2 | 5'UTR - 3'UTR | RNA Info | Genome-wide RNA interference (RNAi) screen | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
Protein Sequence Information
|
MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTVENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQFLIKD
Click to Show/Hide
|
