Host Protein General Information
| Protein Name |
Sorting nexin-12
|
Gene Name |
SNX12
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
SNX12_HUMAN
|
||||||
| Protein Families |
Sorting nexin family
|
||||||||
| Subcellular Location |
Membrane
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Endocytosis | hsa04144 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Zika virus | 3'UTR | RNA Info | RNA-protein interaction detection (RaPID) | HEK293 Cells (Human embryonic kidney cell) | . | Kidney | 42 h | Saint score = 0.97 | . |
| Zika virus | 5'UTR | RNA Info | RNA-protein interaction detection (RaPID) | HEK293 Cells (Human embryonic kidney cell) | . | Kidney | 42 h | Saint score = 0.97 | . |
Protein Sequence Information
|
MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ
Click to Show/Hide
|
