Host Protein General Information
Protein Name |
Cofilin-2
|
Gene Name |
CFL2
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
COF2_HUMAN
|
||||||
Protein Families |
Actin-binding proteins ADF family
|
||||||||
Subcellular Location |
Nucleus matrix
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Fc gamma R-mediated phagocytosis | hsa04666 |
Pathway Map ![]() |
|||||||
Pertussis | hsa05133 |
Pathway Map ![]() |
|||||||
Human immunodeficiency virus 1 infection | hsa05170 |
Pathway Map ![]() |
|||||||
Axon guidance | hsa04360 |
Pathway Map ![]() |
|||||||
Regulation of actin cytoskeleton | hsa04810 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Hepatitis E virus | 3'UTR | RNA Info | RNA-protein interaction detection (RaPID) assay coupled to liquid chromatography with tandem mass spectrometry (LC-MS/MS) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | . | . | . |
Protein Sequence Information
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Click to Show/Hide
|