Host Protein General Information
| Protein Name |
Cofilin-2
|
Gene Name |
CFL2
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
COF2_HUMAN
|
||||||
| Protein Families |
Actin-binding proteins ADF family
|
||||||||
| Subcellular Location |
Nucleus matrix
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Fc gamma R-mediated phagocytosis | hsa04666 |
Pathway Map
|
|||||||
| Pertussis | hsa05133 |
Pathway Map
|
|||||||
| Human immunodeficiency virus 1 infection | hsa05170 |
Pathway Map
|
|||||||
| Axon guidance | hsa04360 |
Pathway Map
|
|||||||
| Regulation of actin cytoskeleton | hsa04810 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Hepatitis E virus | 3'UTR | RNA Info | RNA-protein interaction detection (RaPID) assay coupled to liquid chromatography with tandem mass spectrometry (LC-MS/MS) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | . | . | . |
Protein Sequence Information
|
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Click to Show/Hide
|
