Host Protein General Information
| Protein Name |
Acyl-coenzyme A thioesterase 9
|
Gene Name |
ACOT9
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
ACOT9_HUMAN
|
||||||
| Protein Families |
Acyl coenzyme A hydrolase family
|
||||||||
| EC Number |
3.1.2.-
|
||||||||
| Subcellular Location |
Mitochondrion
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | N region | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Calu-3 cell line | . | Liver | . | P value < 0.05 | . |
| Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 3 h | P = 0.014384069739177 | . |
| Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 1 h | P = 0.0104502538616595 | . |
| Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 0.2 h | P = 0.00445410037141989 | . |
Protein Sequence Information
|
MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVDDIMFQKPVEVGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGESMLYLDGQRHFNSMSGPATLRKDYLVEP
Click to Show/Hide
|
