Host Protein General Information
Protein Name |
V-ATPase 16 kDa proteolipid subunit c
|
Gene Name |
ATP6V0C
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
VATL_HUMAN
|
||||||
Protein Families |
V-ATPase proteolipid subunit family
|
||||||||
Subcellular Location |
Cytoplasmic vesicle; clathrin-coated vesicle
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Vibrio cholerae infection | hsa05110 |
Pathway Map ![]() |
|||||||
Epithelial cell signaling in Helicobacter pylori infection | hsa05120 |
Pathway Map ![]() |
|||||||
Tuberculosis | hsa05152 |
Pathway Map ![]() |
|||||||
Human papillomavirus infection | hsa05165 |
Pathway Map ![]() |
|||||||
Rheumatoid arthritis | hsa05323 |
Pathway Map ![]() |
|||||||
Oxidative phosphorylation | hsa00190 |
Pathway Map ![]() |
|||||||
Metabolic pathways | hsa01100 |
Pathway Map ![]() |
|||||||
Lysosome | hsa04142 |
Pathway Map ![]() |
|||||||
Phagosome | hsa04145 |
Pathway Map ![]() |
|||||||
Synaptic vesicle cycle | hsa04721 |
Pathway Map ![]() |
|||||||
Collecting duct acid secretion | hsa04966 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Dengue virus 2 | 5'UTR - 3'UTR | RNA Info | Genome-wide RNA interference (RNAi) screen | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
Dengue virus 2 | 5'UTR - 3'UTR | RNA Info | Genome-wide RNA interference (RNAi) screen | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | . | . |
Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | . | . |
Protein Sequence Information
MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Click to Show/Hide
|