Host Protein General Information
Protein Name |
Cyclin-dependent kinase inhibitor 2A
|
Gene Name |
CDKN2A
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
CDN2A_HUMAN
|
||||||
Protein Families |
CDKN2 cyclin-dependent kinase inhibitor family
|
||||||||
Subcellular Location |
Cytoplasm
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Human cytomegalovirus infection | hsa05163 |
Pathway Map ![]() |
|||||||
Human T-cell leukemia virus 1 infection | hsa05166 |
Pathway Map ![]() |
|||||||
Endocrine resistance | hsa01522 |
Pathway Map ![]() |
|||||||
Platinum drug resistance | hsa01524 |
Pathway Map ![]() |
|||||||
Cell cycle | hsa04110 |
Pathway Map ![]() |
|||||||
p53 signaling pathway | hsa04115 |
Pathway Map ![]() |
|||||||
Cellular senescence | hsa04218 |
Pathway Map ![]() |
|||||||
Cushing syndrome | hsa04934 |
Pathway Map ![]() |
|||||||
Pathways in cancer | hsa05200 |
Pathway Map ![]() |
|||||||
Viral carcinogenesis | hsa05203 |
Pathway Map ![]() |
|||||||
MicroRNAs in cancer | hsa05206 |
Pathway Map ![]() |
|||||||
Pancreatic cancer | hsa05212 |
Pathway Map ![]() |
|||||||
Glioma | hsa05214 |
Pathway Map ![]() |
|||||||
Melanoma | hsa05218 |
Pathway Map ![]() |
|||||||
Bladder cancer | hsa05219 |
Pathway Map ![]() |
|||||||
Chronic myeloid leukemia | hsa05220 |
Pathway Map ![]() |
|||||||
Non-small cell lung cancer | hsa05223 |
Pathway Map ![]() |
|||||||
Hepatocellular carcinoma | hsa05225 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Sindbis virus | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Click to Show/Hide
|