Host Protein General Information
| Protein Name |
Cyclin-dependent kinase inhibitor 2A
|
Gene Name |
CDKN2A
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
CDN2A_HUMAN
|
||||||
| Protein Families |
CDKN2 cyclin-dependent kinase inhibitor family
|
||||||||
| Subcellular Location |
Cytoplasm
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Human cytomegalovirus infection | hsa05163 |
Pathway Map
|
|||||||
| Human T-cell leukemia virus 1 infection | hsa05166 |
Pathway Map
|
|||||||
| Endocrine resistance | hsa01522 |
Pathway Map
|
|||||||
| Platinum drug resistance | hsa01524 |
Pathway Map
|
|||||||
| Cell cycle | hsa04110 |
Pathway Map
|
|||||||
| p53 signaling pathway | hsa04115 |
Pathway Map
|
|||||||
| Cellular senescence | hsa04218 |
Pathway Map
|
|||||||
| Cushing syndrome | hsa04934 |
Pathway Map
|
|||||||
| Pathways in cancer | hsa05200 |
Pathway Map
|
|||||||
| Viral carcinogenesis | hsa05203 |
Pathway Map
|
|||||||
| MicroRNAs in cancer | hsa05206 |
Pathway Map
|
|||||||
| Pancreatic cancer | hsa05212 |
Pathway Map
|
|||||||
| Glioma | hsa05214 |
Pathway Map
|
|||||||
| Melanoma | hsa05218 |
Pathway Map
|
|||||||
| Bladder cancer | hsa05219 |
Pathway Map
|
|||||||
| Chronic myeloid leukemia | hsa05220 |
Pathway Map
|
|||||||
| Non-small cell lung cancer | hsa05223 |
Pathway Map
|
|||||||
| Hepatocellular carcinoma | hsa05225 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Sindbis virus | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
|
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Click to Show/Hide
|
