Host Protein General Information

  Protein Name
Cytochrome c
  Gene Name
CYCS
  Host Species
Homo sapiens
  Uniprot Entry Name
CYC_HUMAN
  Protein Families
Cytochrome c family
  Subcellular Location
Mitochondrion intermembrane space
  External Link
NCBI Gene ID
54205
Uniprot ID
P99999
Ensembl ID
ENSG00000163882
HGNC ID
19986
  Related KEGG Pathway
Pathogenic Escherichia coli infection hsa05130            Pathway Map 
Shigellosis hsa05131            Pathway Map 
Salmonella infection hsa05132            Pathway Map 
Legionellosis hsa05134            Pathway Map 
Toxoplasmosis hsa05145            Pathway Map 
Tuberculosis hsa05152            Pathway Map 
Hepatitis C hsa05160            Pathway Map 
Hepatitis B hsa05161            Pathway Map 
Measles hsa05162            Pathway Map 
Human cytomegalovirus infection hsa05163            Pathway Map 
Influenza A hsa05164            Pathway Map 
Kaposi sarcoma-associated herpesvirus infection hsa05167            Pathway Map 
Herpes simplex virus 1 infection hsa05168            Pathway Map 
Epstein-Barr virus infection hsa05169            Pathway Map 
Human immunodeficiency virus 1 infection hsa05170            Pathway Map 
Oxidative phosphorylation hsa00190            Pathway Map 
Metabolic pathways hsa01100            Pathway Map 
Platinum drug resistance hsa01524            Pathway Map 
p53 signaling pathway hsa04115            Pathway Map 
Apoptosis hsa04210            Pathway Map 
Apoptosis - multiple species hsa04215            Pathway Map 
Non-alcoholic fatty liver disease hsa04932            Pathway Map 
Alzheimer disease hsa05010            Pathway Map 
Parkinson disease hsa05012            Pathway Map 
Amyotrophic lateral sclerosis hsa05014            Pathway Map 
Huntington disease hsa05016            Pathway Map 
Spinocerebellar ataxia hsa05017            Pathway Map 
Prion disease hsa05020            Pathway Map 
Pathways of neurodegeneration - multiple diseases hsa05022            Pathway Map 
Pathways in cancer hsa05200            Pathway Map 
Colorectal cancer hsa05210            Pathway Map 
Small cell lung cancer hsa05222            Pathway Map 
Viral myocarditis hsa05416            Pathway Map 
Lipid and atherosclerosis hsa05417            Pathway Map 
  3D Structure
PDB ID: 1J3S 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
acetylcysteine . 12035  D06XGW  DrugCentral

Protein Sequence Information

MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
    Click to Show/Hide