Host Protein General Information

  Protein Name
Myosin regulatory light chain 12B
  Gene Name
MYL12B
  Host Species
Homo sapiens
  Uniprot Entry Name
ML12B_HUMAN
  External Link
NCBI Gene ID
103910
Uniprot ID
O14950
Ensembl ID
ENSG00000118680; ENSG00000101608
HGNC ID
29827
  Related KEGG Pathway
Platelet activation hsa04611            Pathway Map 
Leukocyte transendothelial migration hsa04670            Pathway Map 
Shigellosis hsa05131            Pathway Map 
Salmonella infection hsa05132            Pathway Map 
Regulation of actin cytoskeleton hsa04810            Pathway Map 
Motor proteins hsa04814            Pathway Map 
Focal adhesion hsa04510            Pathway Map 
Adherens junction hsa04520            Pathway Map 
Tight junction hsa04530            Pathway Map 
Axon guidance hsa04360            Pathway Map 
  3D Structure
AlphaFold ID: O14950 
  2D PNG Download  
  mmCIF File Download   
  PDB File Download   

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .

Protein Sequence Information

MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
    Click to Show/Hide