Host Protein General Information
| Protein Name |
Actin-related protein 2/3 complex subunit 2
|
Gene Name |
ARPC2
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
ARPC2_HUMAN
|
||||||
| Protein Families |
ARPC2 family
|
||||||||
| Subcellular Location |
Cytoplasm; cytoskeleton
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Fc gamma R-mediated phagocytosis | hsa04666 |
Pathway Map
|
|||||||
| Bacterial invasion of epithelial cells | hsa05100 |
Pathway Map
|
|||||||
| Pathogenic Escherichia coli infection | hsa05130 |
Pathway Map
|
|||||||
| Shigellosis | hsa05131 |
Pathway Map
|
|||||||
| Salmonella infection | hsa05132 |
Pathway Map
|
|||||||
| Yersinia infection | hsa05135 |
Pathway Map
|
|||||||
| Regulation of actin cytoskeleton | hsa04810 |
Pathway Map
|
|||||||
| Tight junction | hsa04530 |
Pathway Map
|
|||||||
| Endocytosis | hsa04144 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -5.633055271 | FZR = 1.03394E-05 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -0.917242916 | FZR = 1 |
Protein Sequence Information
|
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Click to Show/Hide
|
