Protein Name
Complex I-30kD
  Gene Name
NDUFS3
  Host Species
Homo sapiens
  Uniprot Entry Name
NDUS3_HUMAN
  Protein Families
Complex I 30 kDa subunit family
  EC Number
7.1.1.2
  Subcellular Location
Mitochondrion inner membrane
  External Link
NCBI Gene ID
4722
Uniprot ID
O75489
Ensembl ID
ENSG00000213619
HGNC ID
7710
  Related KEGG Pathway
Chemical carcinogenesis - reactive oxygen species hsa05208            Pathway Map 
Diabetic cardiomyopathy hsa05415            Pathway Map 
Non-alcoholic fatty liver disease hsa04932            Pathway Map 
Oxidative phosphorylation hsa00190            Pathway Map 
Thermogenesis hsa04714            Pathway Map 
Metabolic pathways hsa01100            Pathway Map 
Retrograde endocannabinoid signaling hsa04723            Pathway Map 
Alzheimer disease hsa05010            Pathway Map 
Parkinson disease hsa05012            Pathway Map 
Amyotrophic lateral sclerosis hsa05014            Pathway Map 
Huntington disease hsa05016            Pathway Map 
Prion disease hsa05020            Pathway Map 
Pathways of neurodegeneration - multiple diseases hsa05022            Pathway Map 
  3D Structure

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Drug Name DrunkBank ID Pubchem ID TTD ID REF
ME-344 . 68026984  D03IXK  DGIdb
NV-128 . 68026984  D03IXK  DGIdb

MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
    Click to Show/Hide