Host Protein General Information
Protein Name |
Aspartate aminotransferase
|
Gene Name |
GOT2
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
AATM_HUMAN
|
||||||
Protein Families |
Class-I pyridoxal-phosphate-dependent aminotransferase family
|
||||||||
EC Number |
2.6.1.1; 2.6.1.7
|
||||||||
Subcellular Location |
Mitochondrion matrix
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Arginine biosynthesis | hsa00220 |
Pathway Map ![]() |
|||||||
Alanine, aspartate and glutamate metabolism | hsa00250 |
Pathway Map ![]() |
|||||||
Cysteine and methionine metabolism | hsa00270 |
Pathway Map ![]() |
|||||||
Arginine and proline metabolism | hsa00330 |
Pathway Map ![]() |
|||||||
Tyrosine metabolism | hsa00350 |
Pathway Map ![]() |
|||||||
Phenylalanine metabolism | hsa00360 |
Pathway Map ![]() |
|||||||
Phenylalanine, tyrosine and tryptophan biosynthesis | hsa00400 |
Pathway Map ![]() |
|||||||
Fat digestion and absorption | hsa04975 |
Pathway Map ![]() |
|||||||
Metabolic pathways | hsa01100 |
Pathway Map ![]() |
|||||||
Carbon metabolism | hsa01200 |
Pathway Map ![]() |
|||||||
2-Oxocarboxylic acid metabolism | hsa01210 |
Pathway Map ![]() |
|||||||
Biosynthesis of amino acids | hsa01230 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Sindbis virus | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
Potential Drug(s) that Targets This Protein
Drug Name | DrunkBank ID | Pubchem ID | TTD ID | REF | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
aspartic acid | . | . | . | DrugCentral |
Protein Sequence Information
MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK
Click to Show/Hide
|