Host Protein General Information
Protein Name |
Phospholipase A2
|
Gene Name |
PLA2G1B
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
PA21B_HUMAN
|
||||||
Protein Families |
Phospholipase A2 family
|
||||||||
EC Number |
3.1.1.4
|
||||||||
Subcellular Location |
Secreted
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Vascular smooth muscle contraction | hsa04270 |
Pathway Map ![]() |
|||||||
Pancreatic secretion | hsa04972 |
Pathway Map ![]() |
|||||||
Fat digestion and absorption | hsa04975 |
Pathway Map ![]() |
|||||||
Metabolic pathways | hsa01100 |
Pathway Map ![]() |
|||||||
Glycerophospholipid metabolism | hsa00564 |
Pathway Map ![]() |
|||||||
Ether lipid metabolism | hsa00565 |
Pathway Map ![]() |
|||||||
Arachidonic acid metabolism | hsa00590 |
Pathway Map ![]() |
|||||||
Linoleic acid metabolism | hsa00591 |
Pathway Map ![]() |
|||||||
alpha-Linolenic acid metabolism | hsa00592 |
Pathway Map ![]() |
|||||||
Ras signaling pathway | hsa04014 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Dengue virus | 5'UTR - 3'UTR | RNA Info | UV cross-linking (UVX) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 30 h | . | . |
Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | UV cross-linking followed by antisense-mediated affinity purification and mass spectrometry | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 30 h | . | . |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
Click to Show/Hide
|