Host Protein General Information

  Protein Name
Cytochrome c oxidase polypeptide IV
  Gene Name
COX4I1
  Host Species
Homo sapiens
  Uniprot Entry Name
COX41_HUMAN
  Protein Families
Cytochrome c oxidase IV family
  Subcellular Location
Mitochondrion inner membrane
  External Link
NCBI Gene ID
1327
Uniprot ID
P13073
Ensembl ID
ENSG00000131143
HGNC ID
2265
  Related KEGG Pathway
Chemical carcinogenesis - reactive oxygen species hsa05208            Pathway Map 
Diabetic cardiomyopathy hsa05415            Pathway Map 
Cardiac muscle contraction hsa04260            Pathway Map 
Non-alcoholic fatty liver disease hsa04932            Pathway Map 
Oxidative phosphorylation hsa00190            Pathway Map 
Thermogenesis hsa04714            Pathway Map 
Metabolic pathways hsa01100            Pathway Map 
Alzheimer disease hsa05010            Pathway Map 
Parkinson disease hsa05012            Pathway Map 
Amyotrophic lateral sclerosis hsa05014            Pathway Map 
Huntington disease hsa05016            Pathway Map 
Prion disease hsa05020            Pathway Map 
Pathways of neurodegeneration - multiple diseases hsa05022            Pathway Map 
  3D Structure
PDB ID: 5Z62 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .

Protein Sequence Information

MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
    Click to Show/Hide