Host Protein General Information
| Protein Name |
Phosphoglycerate mutase 2
|
Gene Name |
PGAM2
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
PGAM2_HUMAN
|
||||||
| Protein Families |
Phosphoglycerate mutase family, BPG-dependent PGAM subfamily
|
||||||||
| EC Number |
5.4.2.11; 5.4.2.4
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Glycine, serine and threonine metabolism | hsa00260 |
Pathway Map
|
|||||||
| Central carbon metabolism in cancer | hsa05230 |
Pathway Map
|
|||||||
| Glycolysis / Gluconeogenesis | hsa00010 |
Pathway Map
|
|||||||
| Glucagon signaling pathway | hsa04922 |
Pathway Map
|
|||||||
| Metabolic pathways | hsa01100 |
Pathway Map
|
|||||||
| Carbon metabolism | hsa01200 |
Pathway Map
|
|||||||
| Biosynthesis of amino acids | hsa01230 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -0.653258804 | FZR = 1 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -2.914011173 | FZR = 1 |
Protein Sequence Information
|
MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK
Click to Show/Hide
|
