Host Protein General Information

  Protein Name
PKA C-beta
  Gene Name
PRKACB
  Host Species
Homo sapiens
  Uniprot Entry Name
KAPCB_HUMAN
  Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, cAMP subfamily
  EC Number
2.7.11.11
  Subcellular Location
Cytoplasm
  External Link
NCBI Gene ID
5567
Uniprot ID
P22694
Ensembl ID
ENSG00000142875
HGNC ID
9381
  Related KEGG Pathway
Chemokine signaling pathway hsa04062            Pathway Map 
Platelet activation hsa04611            Pathway Map 
Vibrio cholerae infection hsa05110            Pathway Map 
Amoebiasis hsa05146            Pathway Map 
Human cytomegalovirus infection hsa05163            Pathway Map 
Human papillomavirus infection hsa05165            Pathway Map 
Human T-cell leukemia virus 1 infection hsa05166            Pathway Map 
Endocrine resistance hsa01522            Pathway Map 
Longevity regulating pathway hsa04211            Pathway Map 
Longevity regulating pathway - multiple species hsa04213            Pathway Map 
Pathways in cancer hsa05200            Pathway Map 
Viral carcinogenesis hsa05203            Pathway Map 
Proteoglycans in cancer hsa05205            Pathway Map 
Chemical carcinogenesis - receptor activation hsa05207            Pathway Map 
Dilated cardiomyopathy hsa05414            Pathway Map 
Oocyte meiosis hsa04114            Pathway Map 
Tight junction hsa04530            Pathway Map 
Gap junction hsa04540            Pathway Map 
Adrenergic signaling in cardiomyocytes hsa04261            Pathway Map 
Vascular smooth muscle contraction hsa04270            Pathway Map 
Salivary secretion hsa04970            Pathway Map 
Gastric acid secretion hsa04971            Pathway Map 
Bile secretion hsa04976            Pathway Map 
Cushing syndrome hsa04934            Pathway Map 
Insulin signaling pathway hsa04910            Pathway Map 
Insulin secretion hsa04911            Pathway Map 
GnRH signaling pathway hsa04912            Pathway Map 
Ovarian steroidogenesis hsa04913            Pathway Map 
Progesterone-mediated oocyte maturation hsa04914            Pathway Map 
Estrogen signaling pathway hsa04915            Pathway Map 
Melanogenesis hsa04916            Pathway Map 
Thyroid hormone synthesis hsa04918            Pathway Map 
Thyroid hormone signaling pathway hsa04919            Pathway Map 
Oxytocin signaling pathway hsa04921            Pathway Map 
Glucagon signaling pathway hsa04922            Pathway Map 
Regulation of lipolysis in adipocytes hsa04923            Pathway Map 
Renin secretion hsa04924            Pathway Map 
Aldosterone synthesis and secretion hsa04925            Pathway Map 
Relaxin signaling pathway hsa04926            Pathway Map 
Cortisol synthesis and secretion hsa04927            Pathway Map 
Parathyroid hormone synthesis, secretion and action hsa04928            Pathway Map 
Growth hormone synthesis, secretion and action hsa04935            Pathway Map 
Circadian entrainment hsa04713            Pathway Map 
Thermogenesis hsa04714            Pathway Map 
Endocrine and other factor-regulated calcium reabsorption hsa04961            Pathway Map 
Vasopressin-regulated water reabsorption hsa04962            Pathway Map 
Long-term potentiation hsa04720            Pathway Map 
Retrograde endocannabinoid signaling hsa04723            Pathway Map 
Glutamatergic synapse hsa04724            Pathway Map 
Cholinergic synapse hsa04725            Pathway Map 
Serotonergic synapse hsa04726            Pathway Map 
GABAergic synapse hsa04727            Pathway Map 
Dopaminergic synapse hsa04728            Pathway Map 
Parkinson disease hsa05012            Pathway Map 
Prion disease hsa05020            Pathway Map 
Olfactory transduction hsa04740            Pathway Map 
Taste transduction hsa04742            Pathway Map 
Inflammatory mediator regulation of TRP channels hsa04750            Pathway Map 
MAPK signaling pathway hsa04010            Pathway Map 
Ras signaling pathway hsa04014            Pathway Map 
Calcium signaling pathway hsa04020            Pathway Map 
cAMP signaling pathway hsa04024            Pathway Map 
Wnt signaling pathway hsa04310            Pathway Map 
Hedgehog signaling pathway hsa04340            Pathway Map 
Apelin signaling pathway hsa04371            Pathway Map 
Cocaine addiction hsa05030            Pathway Map 
Amphetamine addiction hsa05031            Pathway Map 
Morphine addiction hsa05032            Pathway Map 
Alcoholism hsa05034            Pathway Map 
Autophagy - animal hsa04140            Pathway Map 
  3D Structure
AlphaFold ID: P22694 
  2D PNG Download  
  mmCIF File Download   
  PDB File Download   

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -1.164598859 FZR = 1
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = 0.17733093 FZR = 1

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
FASUDIL . 3547  D03KKR  DGIdb
GSK-690693 . 16725726  D0MS3Z  DGIdb
midostaurin . 9829523  D07NVU  DrugCentral
ruboxistaurin . 153999  D0W3LI  DrugCentral
STAUROSPORINE . 44259  D0E3TC  DGIdb

Protein Sequence Information

MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
    Click to Show/Hide