Host Protein General Information
Protein Name |
Ras-related protein Rab-5B
|
Gene Name |
RAB5B
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
RAB5B_HUMAN
|
||||||
Protein Families |
Small GTPase superfamily, Rab family
|
||||||||
EC Number |
3.6.5.2
|
||||||||
Subcellular Location |
Cell membrane
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Salmonella infection | hsa05132 |
Pathway Map ![]() |
|||||||
Tuberculosis | hsa05152 |
Pathway Map ![]() |
|||||||
Amoebiasis | hsa05146 |
Pathway Map ![]() |
|||||||
Vasopressin-regulated water reabsorption | hsa04962 |
Pathway Map ![]() |
|||||||
Ras signaling pathway | hsa04014 |
Pathway Map ![]() |
|||||||
Endocytosis | hsa04144 |
Pathway Map ![]() |
|||||||
Phagosome | hsa04145 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -2.27026676 | FZR = 1 |
Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = 4.06175516 | FZR = 0.042909232 |
Protein Sequence Information
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
Click to Show/Hide
|