Host Protein General Information
| Protein Name |
Ras-related protein Rab-5B
|
Gene Name |
RAB5B
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
RAB5B_HUMAN
|
||||||
| Protein Families |
Small GTPase superfamily, Rab family
|
||||||||
| EC Number |
3.6.5.2
|
||||||||
| Subcellular Location |
Cell membrane
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Salmonella infection | hsa05132 |
Pathway Map
|
|||||||
| Tuberculosis | hsa05152 |
Pathway Map
|
|||||||
| Amoebiasis | hsa05146 |
Pathway Map
|
|||||||
| Vasopressin-regulated water reabsorption | hsa04962 |
Pathway Map
|
|||||||
| Ras signaling pathway | hsa04014 |
Pathway Map
|
|||||||
| Endocytosis | hsa04144 |
Pathway Map
|
|||||||
| Phagosome | hsa04145 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -2.27026676 | FZR = 1 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = 4.06175516 | FZR = 0.042909232 |
Protein Sequence Information
|
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
Click to Show/Hide
|
