Host Protein General Information

  Protein Name
PP-1B
  Gene Name
PPP1CB
  Host Species
Homo sapiens
  Uniprot Entry Name
PP1B_HUMAN
  Protein Families
PPP phosphatase family
  EC Number
3.1.3.16; 3.1.3.53
  Subcellular Location
Cytoplasm
  External Link
NCBI Gene ID
5500
Uniprot ID
P62140
Ensembl ID
ENSG00000213639
HGNC ID
9282
  Related KEGG Pathway
Platelet activation hsa04611            Pathway Map 
Herpes simplex virus 1 infection hsa05168            Pathway Map 
Proteoglycans in cancer hsa05205            Pathway Map 
Diabetic cardiomyopathy hsa05415            Pathway Map 
Oocyte meiosis hsa04114            Pathway Map 
Cellular senescence hsa04218            Pathway Map 
Regulation of actin cytoskeleton hsa04810            Pathway Map 
Focal adhesion hsa04510            Pathway Map 
Adrenergic signaling in cardiomyocytes hsa04261            Pathway Map 
Vascular smooth muscle contraction hsa04270            Pathway Map 
Insulin resistance hsa04931            Pathway Map 
Insulin signaling pathway hsa04910            Pathway Map 
Oxytocin signaling pathway hsa04921            Pathway Map 
Long-term potentiation hsa04720            Pathway Map 
Dopaminergic synapse hsa04728            Pathway Map 
Inflammatory mediator regulation of TRP channels hsa04750            Pathway Map 
cGMP-PKG signaling pathway hsa04022            Pathway Map 
cAMP signaling pathway hsa04024            Pathway Map 
Hippo signaling pathway hsa04390            Pathway Map 
Amphetamine addiction hsa05031            Pathway Map 
Alcoholism hsa05034            Pathway Map 
mRNA surveillance pathway hsa03015            Pathway Map 
  3D Structure
AlphaFold ID: . 
  2D PNG Download  
  mmCIF File Download   
  PDB File Download   

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -5.836536365 FZR = 3.23514E-06
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = 0.274148479 FZR = 1
Human coronavirus OC43 (strain hCov-OC43/VR-759 Quebec/2019) Not Specified Virus Region RNA Info liquid chromatography with tandem mass spectrometry (LC-MS/MS) HCT-8 cells (Human ileocaecal adenocarcinoma cell) . Ileocecum 12h; 24; 36h; 48h p_value < 0.05; FDR < 10% .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) Not Specified Virus Region RNA Info RNAantisensepurificationandquantitativemassspectrometry(RAP-MS); Tandemmasstag(TMT)labelling; liquidchromatographycoupledwithtandemmassspectrometry(LC-MS/MS); Westernblot Huh7 cells (liver carcinoma celll ine) . Liver 24h log2 fold change = 7.46165E+14 .

Protein Sequence Information

MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
    Click to Show/Hide