Host Protein General Information
| Protein Name |
PP2A-beta
|
Gene Name |
PPP2CB
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
PP2AB_HUMAN
|
||||||
| Protein Families |
PPP phosphatase family, PP-1 subfamily
|
||||||||
| EC Number |
3.1.3.16
|
||||||||
| Subcellular Location |
Cytoplasm
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Chagas disease | hsa05142 |
Pathway Map
|
|||||||
| Hepatitis C | hsa05160 |
Pathway Map
|
|||||||
| Human papillomavirus infection | hsa05165 |
Pathway Map
|
|||||||
| Cell cycle | hsa04110 |
Pathway Map
|
|||||||
| Oocyte meiosis | hsa04114 |
Pathway Map
|
|||||||
| Tight junction | hsa04530 |
Pathway Map
|
|||||||
| Adrenergic signaling in cardiomyocytes | hsa04261 |
Pathway Map
|
|||||||
| Dopaminergic synapse | hsa04728 |
Pathway Map
|
|||||||
| Long-term depression | hsa04730 |
Pathway Map
|
|||||||
| Sphingolipid signaling pathway | hsa04071 |
Pathway Map
|
|||||||
| PI3K-Akt signaling pathway | hsa04151 |
Pathway Map
|
|||||||
| AMPK signaling pathway | hsa04152 |
Pathway Map
|
|||||||
| TGF-beta signaling pathway | hsa04350 |
Pathway Map
|
|||||||
| Hippo signaling pathway | hsa04390 |
Pathway Map
|
|||||||
| mRNA surveillance pathway | hsa03015 |
Pathway Map
|
|||||||
| Autophagy - other | hsa04136 |
Pathway Map
|
|||||||
| Autophagy - animal | hsa04140 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Sindbis virus | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
Protein Sequence Information
|
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Click to Show/Hide
|
