Host Protein General Information
| Protein Name |
Cyclin-dependent kinase 6
|
Gene Name |
CDK6
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
CDK6_HUMAN
|
||||||
| Protein Families |
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
|
||||||||
| EC Number |
2.7.11.22
|
||||||||
| Subcellular Location |
Cytoplasm; Nucleus; Cell projection; ruffle
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Hepatitis C | hsa05160 |
Pathway Map
|
|||||||
| Measles | hsa05162 |
Pathway Map
|
|||||||
| Human cytomegalovirus infection | hsa05163 |
Pathway Map
|
|||||||
| Influenza A | hsa05164 |
Pathway Map
|
|||||||
| Human papillomavirus infection | hsa05165 |
Pathway Map
|
|||||||
| Kaposi sarcoma-associated herpesvirus infection | hsa05167 |
Pathway Map
|
|||||||
| Epstein-Barr virus infection | hsa05169 |
Pathway Map
|
|||||||
| Cell cycle | hsa04110 |
Pathway Map
|
|||||||
| p53 signaling pathway | hsa04115 |
Pathway Map
|
|||||||
| PI3K-Akt signaling pathway | hsa04151 |
Pathway Map
|
|||||||
| Cellular senescence | hsa04218 |
Pathway Map
|
|||||||
| Cushing syndrome | hsa04934 |
Pathway Map
|
|||||||
| Pathways in cancer | hsa05200 |
Pathway Map
|
|||||||
| Viral carcinogenesis | hsa05203 |
Pathway Map
|
|||||||
| MicroRNAs in cancer | hsa05206 |
Pathway Map
|
|||||||
| Pancreatic cancer | hsa05212 |
Pathway Map
|
|||||||
| Glioma | hsa05214 |
Pathway Map
|
|||||||
| Melanoma | hsa05218 |
Pathway Map
|
|||||||
| Chronic myeloid leukemia | hsa05220 |
Pathway Map
|
|||||||
| Small cell lung cancer | hsa05222 |
Pathway Map
|
|||||||
| Non-small cell lung cancer | hsa05223 |
Pathway Map
|
|||||||
| Breast cancer | hsa05224 |
Pathway Map
|
|||||||
| Hepatocellular carcinoma | hsa05225 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -9.804879549 | FZR = 9.7942E-20 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -10.33699096 | FZR = 6.25E-22 |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
|
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Click to Show/Hide
|
