Host Protein General Information
Protein Name |
Diablo IAP-binding mitochondrial protein
|
Gene Name |
DIABLO
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
DBLOH_HUMAN
|
||||||
Subcellular Location |
Mitochondrion
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Apoptosis | hsa04210 |
Pathway Map ![]() |
|||||||
Apoptosis - multiple species | hsa04215 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = 2.844592197 | FZR = 1 |
Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = 1.057751141 | FZR = 1 |
Potential Drug(s) that Targets This Protein
Drug Name | DrunkBank ID | Pubchem ID | TTD ID | REF | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
CLADRIBINE | . | 20279 | D05GJW | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
RESVERATROL | . | 445154 | D0U3EP | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
STAUROSPORINE | . | 44259 | D0E3TC | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
UCN-01 | . | 72271 | D0Z9VY | DGIdb |
Protein Sequence Information
MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Click to Show/Hide
|