Host Protein General Information
| Protein Name |
DDB1- and CUL4-associated factor 13
|
Gene Name |
DCAF13
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
DCA13_HUMAN
|
||||||
| Protein Families |
WD repeat DCAF13/WDSOF1 family
|
||||||||
| Subcellular Location |
Nucleus
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Sindbis virus | 5'UTR - 3'UTR | RNA Info | comparative RIC | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 18 h | P = -0.541437721946193 | . |
| Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 1 h | P = 8.88382971135138e-05 | . |
| Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 3 h | P = 0.000425148415527101 | . |
| Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 0.2 h | P = 0.000225238995890104 | . |
Protein Sequence Information
|
MKVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREYIRALNATKLERVFAKPFLASLDGHRDGVNCLAKHPEKLATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVNRIKHSKPGSVPLVSEKKKHVVAVVK
Click to Show/Hide
|
