Host Protein General Information
| Protein Name |
Calreticulin
|
Gene Name |
CALR
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
CALR_HUMAN
|
||||||
| Protein Families |
Calreticulin family
|
||||||||
| Subcellular Location |
Endoplasmic reticulum lumen
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Antigen processing and presentation | hsa04612 |
Pathway Map
|
|||||||
| Chagas disease | hsa05142 |
Pathway Map
|
|||||||
| Human cytomegalovirus infection | hsa05163 |
Pathway Map
|
|||||||
| Human T-cell leukemia virus 1 infection | hsa05166 |
Pathway Map
|
|||||||
| Herpes simplex virus 1 infection | hsa05168 |
Pathway Map
|
|||||||
| Epstein-Barr virus infection | hsa05169 |
Pathway Map
|
|||||||
| Human immunodeficiency virus 1 infection | hsa05170 |
Pathway Map
|
|||||||
| Protein processing in endoplasmic reticulum | hsa04141 |
Pathway Map
|
|||||||
| Phagosome | hsa04145 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Sindbis virus | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Thiouracil cross-linking mass spectrometry (TUX-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | 28 h | MIST = 4.51 | . |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Thiouracil cross-linking mass spectrometry (TUX-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | 28 h | . | . |
Potential Drug(s) that Targets This Protein
| Drug Name | DrunkBank ID | Pubchem ID | TTD ID | REF | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| GENTAMICIN | . | 3467 | D0L9UU | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OLTIPRAZ | . | 47318 | D0W4NM | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Sequence Information
|
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Click to Show/Hide
|
