Host Protein General Information
Protein Name |
Adenylate kinase isoenzyme 1
|
Gene Name |
AK1
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
KAD1_HUMAN
|
||||||
Protein Families |
Adenylate kinase family, AK1 subfamily
|
||||||||
EC Number |
2.7.4.10; 2.7.4.3; 2.7.4.6
|
||||||||
Subcellular Location |
Cytoplasm
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Metabolic pathways | hsa01100 |
Pathway Map ![]() |
|||||||
Nucleotide metabolism | hsa01232 |
Pathway Map ![]() |
|||||||
Biosynthesis of cofactors | hsa01240 |
Pathway Map ![]() |
|||||||
Thiamine metabolism | hsa00730 |
Pathway Map ![]() |
|||||||
Purine metabolism | hsa00230 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = 0.446533772 | FZR = 1 |
Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = 1.859230128 | FZR = 1 |
Hepatitis E virus | 3'UTR | RNA Info | RNA-protein interaction detection (RaPID) assay coupled to liquid chromatography with tandem mass spectrometry (LC-MS/MS) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | . | . | . |
Protein Sequence Information
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Click to Show/Hide
|